Structure of PDB 1nmd Chain G |
>1nmdG (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] |
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQL RNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFE SATFLGYFKSGLKYKKGGVASGF |
|
PDB | 1nmd The Structure Of The Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism |
Chain | G |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
G |
G41 D42 E73 V121 |
G39 D40 E71 V119 |
|
|
|
|