Structure of PDB 1n34 Chain G

Receptor sequence
>1n34G (length=155) Species: 274 (Thermus thermophilus) [Search protein sequence]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW
3D structure
PDB1n34 Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
ChainG
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G A2 R3 R4 R6 R10 N28 I30 R32 D33 G34 N37 L38 R41 I42 R94 R95 S98 R102 R114 A116 R119 A1 R2 R3 R5 R9 N27 I29 R31 D32 G33 N36 L37 R40 I41 R93 R94 S97 R101 R113 A115 R118 PDBbind-CN: Kd=220uM
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n34, PDBe:1n34, PDBj:1n34
PDBsum1n34
PubMed12464183
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]