Structure of PDB 1mow Chain G

Receptor sequence

>1mowG (length=233) Species: 2275,3055

VSGISAYLLGLIWGDGGLYKLNRSEYRVVITQKSENLIKQFIAPRMQFLI
DELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERILFNGNRFLAYLA
GIVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTERRWFLLVDEIGVGY
VRDRVSDYILSEIKPLHNFLTQLQPFLNFKQKQANLVLKIIELPSAKSPD
KFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD

3D structure

• PDB: 1mow Design, Activity and Structure of a Highly Specific Artificial Endonuclease
• Chain: G
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G1116 D1117
• Catalytic site (residue number reindexed from 1): G105 D106
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	G1020 D1021 G1022 T1041 Q1042 K1043 T1076 R1077 Y1130 K1131 I1178	G14 D15 G16 T31 Q32 K33 T66 R67 Y119 K120 I163
BS02	dna	G	N1032 R1033 S1034 S1067 S1084 K1085 G1116 D1117 G1118 S1119 T1143 Q1144 K1145 A1230 N1233 D1234 S1235 R1238 K1239	N22 R23 S24 S57 S74 K75 G105 D106 G107 S108 T132 Q133 K134 A213 N216 D217 S218 R221 K222

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006314 intron homing

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:1mow, PDBe:1mow, PDBj:1mow
• PDBsum: 1mow
• PubMed: 12419232
• UniProt: P05725|DNE1_CHLRE DNA endonuclease I-CreI;
  P21505|DMO1_DESMO Homing endonuclease I-DmoI