Structure of PDB 1jmz Chain G |
>1jmzG (length=77) Species: 303 (Pseudomonas putida) [Search protein sequence] |
AVAGCTATTDPGWEVDAFGGVSSLCQPMEADLYGCSDPCWWPAQVPDMMS TYQDWNAQASNSAEDWRNLGTVFPKDK |
|
PDB | 1jmz Crystal structure of quinohemoprotein amine dehydrogenase from Pseudomonas putida. Identification of a novel quinone cofactor encaged by multiple thioether cross-bridges. |
Chain | G |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PND |
G |
D12 D33 G36 X43 |
D10 D31 G34 X41 |
|
|
|
|