Structure of PDB 1hwt Chain G

Receptor sequence
>1hwtG (length=70) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKEL
LKDNELKKLRERVKSLEKTL
3D structure
PDB1hwt Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein.
ChainG
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G D111 L114 R118 D53 L56 R60
BS02 dna G R59 R70 K71 R1 R12 K13
BS03 dna G P61 S63 R68 K71 K73 P3 S5 R10 K13 K15
BS04 ZN G C64 C67 C74 C81 C6 C9 C16 C23
BS05 ZN G C64 C84 C93 C6 C26 C35
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hwt, PDBe:1hwt, PDBj:1hwt
PDBsum1hwt
PubMed9886294
UniProtP0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]