Structure of PDB 1hv4 Chain G

Receptor sequence
>1hv4G (length=141) Species: 8846 (Anser indicus) [Search protein sequence]
VLSAADKTNVKGVFSKISGHAEEYGAETLERMFTAYPQTKTYFPHFDLQH
GSAQIKAHGKKVVAALVEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKF
LGHCFLVVVAIHHPSALTAEVHASLDKFLCAVGTVLTAKYR
3D structure
PDB1hv4 The crystal structure of bar-headed goose hemoglobin in deoxy form: the allosteric mechanism of a hemoglobin species with high oxygen affinity.
ChainG
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM G Y42 F43 H45 F46 H58 K61 H87 L91 N97 F98 L101 Y42 F43 H45 F46 H58 K61 H87 L91 N97 F98 L101
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1hv4, PDBe:1hv4, PDBj:1hv4
PDBsum1hv4
PubMed11601851
UniProtP01990|HBA_ANSIN Hemoglobin subunit alpha-A (Gene Name=HBAA)

[Back to BioLiP]