Structure of PDB 1gu6 Chain G

Receptor sequence

>1gu6G (length=441) Species: 562 (Escherichia coli) [Search protein sequence]

VEAKNETFAPQHPDQYLSWKATSEQSERVDALAEDPRLVILWAGYPFSRD
YNKPRGHAFAVTDVRETLRTGAPKNAEDGPLPMACWSCKSPDVARLIQKD
GEDGYFHGKWARGGPEIVNNLGCADCHNTASPEFAKGKPELTLSRPYAAR
AMEAIGKPFEKAGRFDQQSMVCGQCHVEYYFDGKNKAVKFPWDDGMKVEN
MEQYYDKIAFSDWTNSLSKTPMLKAQHPEYETWTAGIHGKNNVTCIDCHM
PKVQNAEGKLYTDHKIGNPFDNFAQTCANCHTQDKAALQKVVAERKQSIN
DLKIKVEDQLVHAHFEAKAALDAGATEAEMKPIQDDIRHAQWRWDLAIAS
HGIHMHAPEEGLRMLGTAMDKAADARTKLARLLATKGITHEIQIPDISTK
EKAQQAIGLNMEQIKAEKQDFIKTVIPQWEEQARKNGLLSQ

3D structure

PDB

1gu6 Structure and Spectroscopy of the Periplasmic Cytochrome C Nitrite Reductase from Escherichia Coli

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.7.2.2: nitrite reductase (cytochrome; ammonia-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	G	H318 Q320	H281 Q283
BS02	CA	G	E215 Y216 K261 Q263	E178 Y179 K224 Q226
BS03	HEC	G	N89 P91 T104 R106 C122 C125 K126 C212 H213 Y216 H264	N52 P54 T67 R69 C85 C88 K89 C175 H176 Y179 H227
BS04	HEC	G	H49 Q52 W56 G159 C160 C163 H164 G174 R201 Q205 I283 M287 K289 Y298 T299 H301	H12 Q15 W19 G122 C123 C126 H127 G137 R164 Q168 I246 M250 K252 Y261 T262 H264
BS05	HEC	G	Q62 P91 R92 H94 F96 A97 D100 C125 L158 C209 C212 H213 H286 I303	Q25 P54 R55 H57 F59 A60 D63 C88 L121 C172 C175 H176 H249 I266
BS06	HEC	G	H213 E266 W270 H275 V280 T281 C282 C285 H286 N305 H391 M392 H393	H176 E229 W233 H238 V243 T244 C245 C248 H249 N268 H354 M355 H356
BS07	HEC	G	I274 H275 V280 C314 C317 H318 R332 M392	I237 H238 V243 C277 C280 H281 R295 M355

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0005509	calcium ion binding
GO:0016491	oxidoreductase activity
GO:0016966	nitric oxide reductase activity
GO:0020037	heme binding
GO:0042279	nitrite reductase (cytochrome, ammonia-forming) activity
GO:0046872	metal ion binding

	Biological Process
GO:0009061	anaerobic respiration
GO:0019645	anaerobic electron transport chain
GO:0042128	nitrate assimilation

	Cellular Component
GO:0030288	outer membrane-bounded periplasmic space
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1gu6, PDBe:1gu6, PDBj:1gu6
PDBsum	1gu6
PubMed	11863430
UniProt	P0ABK9\|NRFA_ECOLI Cytochrome c-552 (Gene Name=nrfA)

[Back to BioLiP]