Structure of PDB 1fdh Chain G

Receptor sequence

>1fdhG (length=146) Species: 9606 (Homo sapiens)

GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSS
ASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDP
ENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

3D structure

• PDB: 1fdh Structure of human foetal deoxyhaemoglobin.
• Chain: G
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	G	H63 V67 S70 L88 H92 L96 N102 F103 L141	H63 V67 S70 L88 H92 L96 N102 F103 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015670 carbon dioxide transport
• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005829 cytosol
• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1fdh, PDBe:1fdh, PDBj:1fdh
• PDBsum: 1fdh
• PubMed: 881729
• UniProt: P69892|HBG2_HUMAN Hemoglobin subunit gamma-2 (Gene Name=HBG2)