Structure of PDB 1eqz Chain G

Receptor sequence
>1eqzG (length=120) Species: 9031 (Gallus gallus) [Search protein sequence]
PRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL
PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK
RVTIMPKDIQLARRIRGERA
3D structure
PDB1eqz Asymmetries in the nucleosome core particle at 2.5 A resolution.
ChainG
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G A24 R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83 A9 R25 Y26 G29 V31 A32 R34 R48 K49 L50 P51 R54 R68
BS02 dna G R40 R42 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118 M120 R25 R27 T30 R48 R57 R68 F69 Q70 S71 R101 V102 T103 M105
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0010467 gene expression
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eqz, PDBe:1eqz, PDBj:1eqz
PDBsum1eqz
PubMed11092917
UniProtP84229|H32_CHICK Histone H3.2 (Gene Name=H3-I)

[Back to BioLiP]