Structure of PDB 1d4x Chain G |
>1d4xG (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] |
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQL RNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFE SATFLGYFKSGLKYKKGGVASGFK |
|
PDB | 1d4x The structure of nonvertebrate actin: implications for the ATP hydrolytic mechanism. |
Chain | G |
Resolution | 1.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
G |
G41 D42 E73 V121 |
G39 D40 E71 V119 |
|
|
|
|