Structure of PDB 1cno Chain G

Receptor sequence
>1cnoG (length=87) Species: 2743 (Marinobacter nauticus) [Search protein sequence]
AGDIEAGKAKAAVCAACHGQNGISQVPIYPNLAGQKEQYLVAALKAYKAG
QRQGGQAPVMQGQATALSDADIANLAAYYASNPAAAA
3D structure
PDB1cno MAD structure of Pseudomonas nautica dimeric cytochrome c552 mimicks the c4 Dihemic cytochrome domain association.
ChainG
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC G C14 C17 H18 Y29 P30 L32 Y39 L44 Y47 Q56 A57 M60 L75 C14 C17 H18 Y29 P30 L32 Y39 L44 Y47 Q56 A57 M60 L75
BS02 HEC G Y39 R52 Y39 R52
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1cno, PDBe:1cno, PDBj:1cno
PDBsum1cno
PubMed10369779
UniProtP82903|CY552_MARNT Cytochrome c-552

[Back to BioLiP]