Structure of PDB 1bos Chain G

Receptor sequence
>1bosG (length=69) Species: 12371 (Phage h30) [Search protein sequence]
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
TIKTNACHNGGGFSEVIFR
3D structure
PDB1bos Structure of the shiga-like toxin I B-pentamer complexed with an analogue of its receptor Gb3.
ChainG
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLA G D2218 W2234 D18 W34
BS02 GAL G T2254 N2255 G2262 T54 N55 G62
BS03 GLA G N2232 R2233 F2263 N32 R33 F63
BS04 GLA G R2233 W2234 N2235 R33 W34 N35
BS05 GAL G T2221 F2230 G2260 T21 F30 G60
Gene Ontology
Biological Process
GO:0019836 hemolysis by symbiont of host erythrocytes
GO:0098676 modulation of host virulence by virus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bos, PDBe:1bos, PDBj:1bos
PDBsum1bos
PubMed9485303
UniProtP69179|STXB_BPH19 Shiga-like toxin 1 subunit B (Gene Name=stxB)

[Back to BioLiP]