Structure of PDB 1bbz Chain G

Receptor sequence

>1bbzG (length=58) Species: 9606 (Homo sapiens)

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVNS

3D structure

• PDB: 1bbz Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
• Chain: G
• Resolution: 1.65 Å

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	G	F3 L6 Y30 G34 S50 I53 T54 P55 S58	F3 L6 Y30 G34 S50 I53 T54 P55 S58
BS02	peptide	G	Y7 F9 S12 D14 E35 W36 W47 P49 Y52	Y7 F9 S12 D14 E35 W36 W47 P49 Y52

External links

• PDB: RCSB:1bbz, PDBe:1bbz, PDBj:1bbz
• PDBsum: 1bbz
• PubMed: 9698566
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)