Structure of PDB 6sgb Chain FO

Receptor sequence

>6sgbFO (length=324) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

RRDPTEFLRVLRRMSRTTSWQKTMLFASKGRMVGYRLTREHYNTVLFSQS
LWGRALEIVRVVRAMQEDKVQPNGATYYYIVNGMGNADHGWNYDFRINRR
LEKIQHWRVALEALEACEANGFDSTDTMHNSALITLVIPGFNRWQQASLL
LQRMLREDRRMHPTMVKFYHDCLVRNNRPREASSLMRLAAERGVHGYEDK
WEADVYKGRPLDSEVMNESEGQASSLAFASLMLRGDQRPLPENLQALLEE
ETTRNIEAERSVPVPFSAGLHATEINSVFRPRVYRQLWYKWQHIANRYRP
TAALKRRQLAPRDSPTGIPGFYRI

3D structure

PDB

6sgb Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	FO	W25 Q26 M29 S33 R59 R65 V66 N103 R105	W20 Q21 M24 S28 R54 R60 V61 N98 R100
BS02	peptide	FO	W57 V293 Y294 Q296 L297 W298 R333	W52 V283 Y284 Q286 L287 W288 R323
BS03	peptide	FO	Q110 W112 R113 R148 Q151 L154	Q105 W107 R108 R143 Q146 L149
BS04	peptide	FO	W149 Q150 S153 Q157 N181 R183 E186 S189 L190 S218	W144 Q145 S148 Q152 N176 R178 E181 S184 L185 S213
BS05	rna	FO	R14 R17 R18 R21 F52 G79 A80 Y83 Y98 F100 R104 T130 F276 I285 N286 Y299 W301 R316 R317 R322 D323 S324 P325 P329 Y332	R9 R12 R13 R16 F47 G74 A75 Y78 Y93 F95 R99 T125 F266 I275 N276 Y289 W291 R306 R307 R312 D313 S314 P315 P319 Y322

Gene Ontology

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005763	mitochondrial small ribosomal subunit

View graph for
Cellular Component

External links

PDB	RCSB:6sgb, PDBe:6sgb, PDBj:6sgb
PDBsum	6sgb
PubMed	31515389
UniProt	Q389F9

[Back to BioLiP]