Structure of PDB 6sga Chain FB

Receptor sequence

>6sgaFB (length=377) Species: 5702 (Trypanosoma brucei brucei)

ELYVPGQQIIPPGLTRYRVDVQYQGNDFDGWWKSTTRQLSRYHARTVLEE
ALAVALDVNTVRVVAGVIPEVGVSVRRLCCHVDVPSHIELQPRTVIQRAT
MWMEKRQQPLAILSYRRCKNQDFHARHSGLRRVYVYRILNRVAPPLFDAG
LQWHVDRHLDVDRMKRFAKALEGTKDFGYFADPKMANALRRAAMSPGGFS
TGAVTEENFQPKATGESHRVTRGKAPKVTMEKGPSNLDRAAALPTFNEYG
QRVVQPGAHGKEYYRVATNLPTVRTVDRLDVVRQDDEVLIWFVGRSFLRH
QIRNMVSVLKAAGHGLWNDLELQQALQSGFEPSRHRFKRERFPTAPAYGL
TLWDVEYPDQHRDDYVQFVDSGPYEQV

3D structure

• PDB: 6sga Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
• Chain: FB
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	FB	W202 K203 S204 T205 R207 G271 I273 E275 V276 R331 H332 R337 K389 M390 N392 R395 R396 S400 P401 G402 G403 T426 R427 G428 A430 P431 K432 H464 R479 R500 S501 F502 R504 S538 R539 H540 R541 R544	W32 K33 S34 T35 R37 G66 I68 E70 V71 R126 H127 R132 K184 M185 N187 R190 R191 S195 P196 G197 G198 T221 R222 G223 A225 P226 K227 H259 R274 R295 S296 F297 R299 S333 R334 H335 R336 R339

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 18:36:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6sga', asym_id = 'FB', title = 'Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6sga', asym_id='FB', title='Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0001522,0003723,0009451,0009982', uniprot = '', pdbid = '6sga', asym_id = 'FB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0001522,0003723,0009451,0009982', uniprot='', pdbid='6sga', asym_id='FB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>