Structure of PDB 7jk9 Chain FA

Receptor sequence

>7jk9FA (length=316) Species: 3702 (Arabidopsis thaliana)

LRKGNVVVTGASSGLGLATAKALAETGKWNVIMACRDFLKAERAAKSVGM
PKDSYTVMHLDLASLDSVRQFVDNFRRTETPLDVLVCNAAVYFPTAKEPT
YSAEGFELSVATNHLGHFLLARLLLDDLKKSDYPSKRLIIVGSITGNTNT
LAGNVPPKANLGDLRGLAGGLNGLNSSAMIDGGDFDGAKAYKDSKVCNML
TMQEFHRRFHEETGVTFASLYPGCIASTGLFREHIPLFRALFPPFQKYIT
KGYVSETESGKRLAQVVSDPSLTKSGVYWSWNNASASFENQLSEEASDVE
KARKVWEISEKLVGLA

3D structure

• PDB: 7jk9 Photocatalytic LPOR forms helical lattices that shape membranes for chlorophyll synthesis.
• Chain: FA
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.33: protochlorophyllide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	FA	G95 S97 S98 L100 R121 K125 L145 D146 L147 N173 A174 A175 V176 V226 Y276 G308 I310 T313 G314 L315 R317	G10 S12 S13 L15 R36 K40 L60 D61 L62 N88 A89 A90 V91 V141 Y191 G223 I225 T228 G229 L230 R232
BS02	PMR	FA	Y177 L236 A237 Y276 Y306 C309 L315 F316 F323 F327	Y92 L151 A152 Y191 Y221 C224 L230 F231 F238 F242

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0016630 protochlorophyllide reductase activity
• GO:0019904 protein domain specific binding

Biological Process

• GO:0009723 response to ethylene
• GO:0015979 photosynthesis
• GO:0015995 chlorophyll biosynthetic process

Cellular Component

• GO:0005829 cytosol
• GO:0009507 chloroplast
• GO:0009527 plastid outer membrane
• GO:0009534 chloroplast thylakoid
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0009707 chloroplast outer membrane
• GO:0009941 chloroplast envelope

External links

• PDB: RCSB:7jk9, PDBe:7jk9, PDBj:7jk9
• PDBsum: 7jk9
• PubMed: 33875834
• UniProt: P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic (Gene Name=PORB)