Structure of PDB 5ib8 Chain F8

Receptor sequence
>5ib8F8 (length=95) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL
3D structure
PDB5ib8 The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
ChainF8
Resolution3.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F8 M1 K2 S14 K16 K25 H31 K33 T35 K36 T37 K40 N41 E44 N55 T56 L57 H58 R60 K62 K63 K64 L66 R68 Y69 L70 G71 K72 R73 P74 D75 M1 K2 S14 K16 K25 H31 K33 T35 K36 T37 K40 N41 E44 N55 T56 L57 H58 R60 K62 K63 K64 L66 R68 Y69 L70 G71 K72 R73 P74 D75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ib8, PDBe:5ib8, PDBj:5ib8
PDBsum5ib8
PubMed27174928
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]