Structure of PDB 5e81 Chain F8

Receptor sequence

>5e81F8 (length=95) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

3D structure

PDB

5e81 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.

Chain

Resolution

2.95 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F8	M1 S14 K16 K25 H31 K33 T35 K36 T37 E38 K40 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75 K78 I80	M1 S14 K16 K25 H31 K33 T35 K36 T37 E38 K40 N41 K53 N55 T56 L57 H58 R60 K62 K63 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75 K78 I80

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5e81, PDBe:5e81, PDBj:5e81
PDBsum	5e81
PubMed	26791911
UniProt	Q5SHP0\|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)