Structure of PDB 4wra Chain F8

Receptor sequence
>4wraF8 (length=93) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKV
VKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG
3D structure
PDB4wra Structural insights into the translational infidelity mechanism.
ChainF8
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F8 S14 K16 K25 H31 T35 K36 T37 E38 N41 E44 K53 N55 T56 L57 H58 R60 K62 K64 R65 L66 Y69 L70 G71 K72 R73 D75 S13 K15 K24 H30 T34 K35 T36 E37 N40 E43 K52 N54 T55 L56 H57 R59 K61 K63 R64 L65 Y68 L69 G70 K71 R72 D74
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wra, PDBe:4wra, PDBj:4wra
PDBsum4wra
PubMed26037619
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]