Structure of PDB 8rd8 Chain F7

Receptor sequence

>8rd8F7 (length=177) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

ARLKALYNNELKQKIKEELGLDNVMQVPKITKITLNMGVGGASQDKKLLE
GAVADMTAIAGQKPVVTKARKSIAGFKIREEWPIGCKVTLRGEQMYEFLD
RLIAVAIPRVRDFRGFSPKAFDGRGNYSLGIKEQIVFPEVDFDKIDRIRG
MDVTITTSAATDDEGRALLKAFGFPFK

3D structure

PDB

8rd8 A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F7	K33 T35 N37 M38 G39 G41 T68 A70 R71 I74 F77 I79 I85 K88 A121 F122 D123 R125 N127 S129 L130 G131 G151 M152 D153 T155 T157	K32 T34 N36 M37 G38 G40 T67 A69 R70 I73 F76 I78 I84 K87 A120 F121 D122 R124 N126 S128 L129 G130 G150 M151 D152 T154 T156
BS02	rna	F7	N24 V25 M26 Q63 K64 V66 K69 K88 V89 T90 R92	N23 V24 M25 Q62 K63 V65 K68 K87 V88 T89 R91

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum	8rd8
PubMed	38355796
UniProt	A0A0M4T1L5

[Back to BioLiP]