Structure of PDB 7a5k Chain F6

Receptor sequence

>7a5kF6 (length=201) Species: 9606 (Homo sapiens)

SRYSPEFKDPLIDKEYYRKEEKYVRELKKTQLIKAAPAGKTSSVFEDPVI
SKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNP
YTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITEC
RDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRW
W

3D structure

• PDB: 7a5k Elongational stalling activates mitoribosome-associated quality control.
• Chain: F6
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F6	S35 R36 N96 M98 G101 G102 K104 L106 L110 V159 R166 Y168 R177 R178 F181 C191 K194 Q197 R198 T199 W241	S1 R2 N55 M57 G60 G61 K63 L65 L69 V118 R125 Y127 R136 R137 F140 C150 K153 Q156 R157 T158 W200
BS02	rna	F6	G164 G165	G123 G124
BS03	rna	F6	L158 V159 P160 I161 L162 G165 R166 F167 Y168 Q169 V170 K228 M229 E231 A232 N233	L117 V118 P119 I120 L121 G124 R125 F126 Y127 Q128 V129 K187 M188 E190 A191 N192

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7a5k, PDBe:7a5k, PDBj:7a5k
• PDBsum: 7a5k
• PubMed: 33243891
• UniProt: Q9Y2R9|RT07_HUMAN Small ribosomal subunit protein uS7m (Gene Name=MRPS7)