Structure of PDB 7a5i Chain F6

Receptor sequence

>7a5iF6 (length=201) Species: 9606 (Homo sapiens)

SRYSPEFKDPLIDKEYYRKEEKYVRELKKTQLIKAAPAGKTSSVFEDPVI
SKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNP
YTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITEC
RDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRW
W

3D structure

• PDB: 7a5i Elongational stalling activates mitoribosome-associated quality control.
• Chain: F6
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F6	S35 R36 S38 K93 N96 M98 G101 G102 K104 L110 G164 R177 R178 F181 R192 K194 R198 L200 M201 W241	S1 R2 S4 K52 N55 M57 G60 G61 K63 L69 G123 R136 R137 F140 R151 K153 R157 L159 M160 W200
BS02	rna	F6	G164 G165	G123 G124
BS03	rna	F6	P160 R166 F167 Y168 Q169 D225 K228 M229 A232	P119 R125 F126 Y127 Q128 D184 K187 M188 A191

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7a5i, PDBe:7a5i, PDBj:7a5i
• PDBsum: 7a5i
• PubMed: 33243891
• UniProt: Q9Y2R9|RT07_HUMAN Small ribosomal subunit protein uS7m (Gene Name=MRPS7)