Structure of PDB 6qnq Chain F5

Receptor sequence

>6qnqF5 (length=92) Species: 300852 (Thermus thermophilus HB8)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKE

3D structure

• PDB: 6qnq Importance of potassium ions for ribosome structure and function revealed by long-wavelength X-ray diffraction.
• Chain: F5
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F5	G22 K23 V30	G21 K22 V29
BS02	rna	F5	S2 K3 K10 R11 I13 V14 A15 N16 I18 Q19 R20 R21 K25 R26 G29 V30 K32 K33 T34 T35 S38 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 A64 K78 K88	S1 K2 K9 R10 I12 V13 A14 N15 I17 Q18 R19 R20 K24 R25 G28 V29 K31 K32 T33 T34 S37 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 R60 A63 K77 K87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6qnq, PDBe:6qnq, PDBj:6qnq
• PDBsum: 6qnq
• PubMed: 31175275
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)