Structure of PDB 4v4g Chain F5

Receptor sequence
>4v4gF5 (length=63) Species: 562 (Escherichia coli) [Search protein sequence]
PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLA
KAEWARMKLMLPR
3D structure
PDB4v4g Structural basis for the control of translation initiation during stress.
ChainF5
Resolution11.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F5 P2 K3 M4 K5 H7 K8 K11 K15 I16 T17 T19 G20 F25 R30 H31 Q32 N33 T34 G35 D39 I41 R42 K44 K46 F48 V49 L62 P63 P1 K2 M3 K4 H6 K7 K10 K14 I15 T16 T18 G19 F24 R29 H30 Q31 N32 T33 G34 D38 I40 R41 K43 K45 F47 V48 L61 P62
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 17:35:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'F5', title = 'Structural basis for the control of translation initiation during stress.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='F5', title='Structural basis for the control of translation initiation during stress.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4g', asym_id = 'F5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4g', asym_id='F5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>