Structure of PDB 7ls2 Chain F3

Receptor sequence

>7ls2F3 (length=100) Species: 10090 (Mus musculus) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF

3D structure

PDB

7ls2 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F3	T2 K3 K4 R5 R6 N7 N8 G9 R10 A11 K12 K13 G14 R15 G16 H17 Q19 R28 K32 K34 K37 K38 F39 Y68 K70 V75 S76 I79 H80 K82 R85 N86 R87 S88 R89 R92 K93 R95 T96 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 A10 K11 K12 G13 R14 G15 H16 Q18 R27 K31 K33 K36 K37 F38 Y67 K69 V74 S75 I78 H79 K81 R84 N85 R86 S87 R88 R91 K92 R94 T95 P96 P97 R99
BS02	ZN	F3	S76 C77	S75 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033119	negative regulation of RNA splicing
GO:0140236	translation at presynapse
GO:0140242	translation at postsynapse

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:0098556	cytoplasmic side of rough endoplasmic reticulum membrane
GO:0098793	presynapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7ls2, PDBe:7ls2, PDBj:7ls2
PDBsum	7ls2
PubMed	34815424
UniProt	P62855\|RS26_MOUSE Small ribosomal subunit protein eS26 (Gene Name=Rps26)