Structure of PDB 6hcf Chain F3

Receptor sequence

>6hcfF3 (length=225) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

NFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNT
LIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN

3D structure

PDB

6hcf ZNF598 Is a Quality Control Sensor of Collided Ribosomes.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F3	F24 K28 K30 R31 R33 R42 R45 K47 Y50 H57 K58 R61 Y64 R65 R69 R72 R75 I97 N98 G99 P102 K106 L110 A127 N130 N145 R165 T172 A175 G179 I184 E187 K201 K211 S213 S214 R216 G217 G218 M219 K222 R241 R244	F2 K6 K8 R9 R11 R20 R23 K25 Y28 H35 K36 R39 Y42 R43 R47 R50 R53 I75 N76 G77 P80 K84 L88 A105 N108 N123 R143 T150 A153 G157 I162 E165 K179 K189 S191 S192 R194 G195 G196 M197 K200 R219 R222
BS02	rna	F3	R133 E136 K221 H225	R111 E114 K199 H203

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005737	cytoplasm
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hcf, PDBe:6hcf, PDBj:6hcf
PDBsum	6hcf
PubMed	30293783
UniProt	G1TUB1

[Back to BioLiP]