Structure of PDB 7ls1 Chain F2

Receptor sequence

>7ls1F2 (length=367) Species: 10090 (Mus musculus) [Search protein sequence]

ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQP
YAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM
FAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELP
LVVEDKVEGYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRR
IQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCI
WTESAFRKLDELYGTWRKAASLKSNYNLPMHKMMNTDLSRILKSPEIQRA
LRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRV
KKLEAAATALATKSEKV

3D structure

PDB

7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F2	R5 K29 R33 I36 F39 T42 N43 R45 N47 N48 R49 Q50 Y52 S55 E56 A58 H60 Q61 T62 S63 T69 G70 A72 V73 R75 I76 P77 R80 G83 R86 Q89 N94 M95 C96 R97 G98 R100 M101 F102 A103 P104 K106 W108 R109 R110 R113 R114 N116 T117 T118 Q119 K120 R121 Y122 A132 K163 T164 K165 K172 K181 K182 Y184 R188 M189 R190 A191 G192 K193 K195 M196 R197 R199 R201 R204 R205 D214 K219 R222 N223 K234 L235 N236 K239 P242 G243 H245 R268 K269 K274 S275 R291 L293 R303 P305 R306 K307 H310 R311 R312 V313 L314 K316 N317 K320 N321 L322 R323 K327 X333 R336 Q343 N346 R350	R4 K28 R32 I35 F38 T41 N42 R44 N46 N47 R48 Q49 Y51 S54 E55 A57 H59 Q60 T61 S62 T68 G69 A71 V72 R74 I75 P76 R79 G82 R85 Q88 N93 M94 C95 R96 G97 R99 M100 F101 A102 P103 K105 W107 R108 R109 R112 R113 N115 T116 T117 Q118 K119 R120 Y121 A131 K162 T163 K164 K171 K180 K181 Y183 R187 M188 R189 A190 G191 K192 K194 M195 R196 R198 R200 R203 R204 D213 K218 R221 N222 K233 L234 N235 K238 P241 G242 H244 R267 K268 K273 S274 R290 L292 R302 P304 R305 K306 H309 R310 R311 V312 L313 K315 N316 K319 N320 L321 R322 K326 X332 R335 Q342 N345 R349
BS02	rna	F2	A53 M196	A52 M195

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0140236	translation at presynapse
GO:0140242	translation at postsynapse

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0098793	presynapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
PDBsum	7ls1
PubMed	34815424
UniProt	Q9D8E6\|RL4_MOUSE Large ribosomal subunit protein uL4 (Gene Name=Rpl4)

[Back to BioLiP]