Structure of PDB 7ls1 Chain F1

Receptor sequence

>7ls1F1 (length=207) Species: 10090 (Mus musculus)

APSRNGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPA
SGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPR
RRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLT
GPVMPIRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKE
AAEQDVE

3D structure

• PDB: 7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
• Chain: F1
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F1	S4 R5 M8 L10 K11 P12 H13 F14 H15 K16 W18 Q19 W25 Q28 P29 R31 K32 R35 R36 R39 K42 R44 R56 R60 P62 T63 Y66 H67 R71 G73 R74 L78 K88 R92 D99 P100 R101 R102 R103 S106 R129 K130 K163 K165 F179 R183 M184 R186 A187 N188 R190 G193 K197 R198	S3 R4 M7 L9 K10 P11 H12 F13 H14 K15 W17 Q18 W24 Q27 P28 R30 K31 R34 R35 R38 K41 R43 R55 R59 P61 T62 Y65 H66 R70 G72 R73 L77 K87 R91 D98 P99 R100 R101 R102 S105 R128 K129 K162 K164 F178 R182 M183 R185 A186 N187 R189 G192 K196 R197
BS02	rna	F1	F26 N27 A30 R34	F25 N26 A29 R33

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0001824 blastocyst development
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0060348 bone development
• GO:0140236 translation at presynapse
• GO:0140242 translation at postsynapse

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:0098793 presynapse
• GO:0098794 postsynapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
• PDBsum: 7ls1
• PubMed: 34815424
• UniProt: P47963|RL13_MOUSE Large ribosomal subunit protein eL13 (Gene Name=Rpl13)