Structure of PDB 9evx Chain F

Receptor sequence

>9evxF (length=34) Species: 197221 (Thermosynechococcus vestitus BP-1)

SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

3D structure

• PDB: 9evx Cryo-electron microscopy reveals hydrogen positions and water networks in photosystem II
• Chain: F
• Resolution: 1.71 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	F	R19 W20 V23 H24 A27 I31	R8 W9 V12 H13 A16 I20

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:9evx, PDBe:9evx, PDBj:9evx
• PDBsum: 9evx
• PubMed: 38900892
• UniProt: Q8DIN9|PSBF_THEVB Cytochrome b559 subunit beta (Gene Name=psbF)