Structure of PDB 8xz3 Chain F

Receptor sequence

>8xz3F (length=182) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

KALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAK
LINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWE
FLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDR
PRGMDITVVTTATNDAEGRALLRALGFPFKEN

3D structure

• PDB: 8xz3 Cryo-EM structures reveal the molecular mechanism of HflX-mediated erythromycin resistance in mycobacteria.
• Chain: F
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	V42 N44 M45 G46 V47 G48 R75 R78 F84 I92 R95 Q128 F129 D130 T132 T136 F137 G138 L139 N140 G158 D160	V37 N39 M40 G41 V42 G43 R70 R73 F79 I87 R90 Q123 F124 D125 T127 T131 F132 G133 L134 N135 G153 D155
BS02	rna	F	N31 Q34 Q70 K71 E73 V74 R76 R95 T97 R99 R102	N26 Q29 Q65 K66 E68 V69 R71 R90 T92 R94 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xz3, PDBe:8xz3, PDBj:8xz3
• PDBsum: 8xz3
• PubMed: 39029461
• UniProt: A0QSG1|RL5_MYCS2 Large ribosomal subunit protein uL5 (Gene Name=rplE)