Structure of PDB 8wmj Chain F

Receptor sequence
>8wmjF (length=161) Species: 52970 (Rhodomonas salina) [Search protein sequence]
DVAGLTPCGESKEFARRLDGSVKKLQTRLSKYEAGTPPALALQKQIDKTK
NRFDRYGKAGLLCGTDGLPHLITDGRWTHSGEFVIPGLLFLYVAGWIGWV
GRSYVLFARTADKPTEKEIIIDVPVALSFVSTGFIWPFSAFKEFTSGNLI
VPADEITVSPR
3D structure
PDB8wmj Growth phase-dependent reorganization of cryptophyte photosystem I antennae.
ChainF
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA F V132 E145 V105 E118
BS02 CLA F G125 G128 G98 G101
BS03 CLA F F171 I177 F144 I150
BS04 CLA F T100 F110 V111 T73 F83 V84
BS05 CLA F F110 G114 F117 A121 F83 G87 F90 A94
BS06 CLA F V120 W123 I124 V127 V157 V93 W96 I97 V100 V130
BS07 CLA F D101 G102 R103 W104 D74 G75 R76 W77
BS08 WVN F T100 G102 F110 W163 T73 G75 F83 W136
BS09 CLA F S158 F161 S131 F134
External links