Structure of PDB 8wha Chain F

Receptor sequence
>8whaF (length=84) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
RDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGF
3D structure
PDB8wha Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
ChainF
Resolution4.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F I46 G48 R78 K79 I30 G32 R62 K63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0009414 response to water deprivation
Cellular Component
GO:0000325 plant-type vacuole
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005777 peroxisome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009506 plasmodesma
GO:0009507 chloroplast
GO:0009536 plastid
GO:0009579 thylakoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wha, PDBe:8wha, PDBj:8wha
PDBsum8wha
PubMed38413824
UniProtP59259|H4_ARATH Histone H4 (Gene Name=At1g07660)

[Back to BioLiP]