Structure of PDB 8wgh Chain F

Receptor sequence
>8wghF (length=153) Species: 141305 (Fittonia albivenis) [Search protein sequence]
DISGLTPCKDSKQFAKREKQQIKKLESSLKLYAPESAPALALNAQIEKTK
RRFDNYGKYGLLCGSDGLPHLIVNGDQRHWGEFITPGILFLYIAGWIGWV
GRSYLIAISGEKKPAMKEIIIDVPLASRIIFRGFIWPVAAYREFLNGDLI
AKD
3D structure
PDB8wgh Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI
ChainF
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA F P204 V205 Y208 P137 V138 Y141
BS02 CLA F G168 Y171 G101 Y104
BS03 CLA F Y171 L172 E185 I188 Y104 L105 E118 I121
BS04 CLA F F150 G154 F157 L158 A161 F83 G87 F90 L91 A94
BS05 CLA F V140 F150 V73 F83
BS06 CLA F L158 P204 A207 F211 I217 L91 P137 A140 F144 I150
BS07 CLA F W163 I164 I197 W96 I97 I130
BS08 CLA F N141 G142 N74 G75
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0019904 protein domain specific binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0005634 nucleus
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0009941 chloroplast envelope
GO:0010287 plastoglobule
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wgh, PDBe:8wgh, PDBj:8wgh
PDBsum8wgh
PubMed39060282
UniProtQ9SHE8|PSAF_ARATH Photosystem I reaction center subunit III, chloroplastic (Gene Name=PSAF)

[Back to BioLiP]