Structure of PDB 8w9d Chain F

Receptor sequence
>8w9dF (length=156) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IDFENEDFCSACNQSGSFLCCDTCPKSFHFLCLDPPIDPNNLPKGDWHCN
ECKFKIFINNSMATLKKIESNFIKQNNNVKIFAKLLFNIDSHNPKQFQLP
NYIKETFPAVKTGSRGQYSDEDENSIKYDFFDKIYKSKMVQKRKLFQFQE
SLIDKL
3D structure
PDB8w9d Structures and dynamics of Rpd3S complex bound to nucleosome.
ChainF
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN F C263 H283 C9 H29
BS02 ZN F C275 H302 C303 C21 H48 C49
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060195 negative regulation of antisense RNA transcription
Cellular Component
GO:0000118 histone deacetylase complex
GO:0005634 nucleus
GO:0032221 Rpd3S complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8w9d, PDBe:8w9d, PDBj:8w9d
PDBsum8w9d
PubMed38598631
UniProtQ04779|RCO1_YEAST Transcriptional regulatory protein RCO1 (Gene Name=RCO1)

[Back to BioLiP]