Structure of PDB 8ux1 Chain F

Receptor sequence
>8ux1F (length=84) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRD
AVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB8ux1 Cryo-EM structure of Ran bound to RCC1 and the nucleosome core particle
ChainF
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R35 R45 I46 S47 G48 R78 K79 R17 R27 I28 S29 G30 R60 K61
BS02 dna F R19 T30 P32 R36 R45 R1 T12 P14 R18 R27
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000228 nuclear chromosome
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ux1, PDBe:8ux1, PDBj:8ux1
PDBsum8ux1
PubMed
UniProtP84040|H4_DROME Histone H4 (Gene Name=His4)

[Back to BioLiP]