Structure of PDB 8urq Chain F

Receptor sequence
>8urqF (length=50) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NKITCTQDFLHQYFVTERVSIQFGLNNKTVKRINKDEFDKAVNCIMSWTN
3D structure
PDB8urq Cryo-EM structure of the yeast Spo11 core complex bound to DNA
ChainF
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F T24 R26 T16 R18
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0007131 reciprocal meiotic recombination
GO:0042138 meiotic DNA double-strand break formation
GO:0051321 meiotic cell cycle
Cellular Component
GO:0000794 condensed nuclear chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8urq, PDBe:8urq, PDBj:8urq
PDBsum8urq
PubMed
UniProtP33323|RE104_YEAST Meiotic recombination protein REC104 (Gene Name=REC104)

[Back to BioLiP]