Structure of PDB 8uri Chain F |
>8uriF (length=70) Species: 562 (Escherichia coli) [Search protein sequence] |
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKAS AVKRHAKKLARENARRTRLY |
|
PDB | 8uri Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome |
Chain | F |
Resolution | 5.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
|