Structure of PDB 8tj5 Chain F

Receptor sequence
>8tj5F (length=173) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PPQIRQEIEQLDQYIQKQVQISHHLKADTIDHDELIDSIPRDVAYLLKSE
SATSQYLKQDLKKISSFKSLIDEDLLDTQTFSVLLQQLLTLDKFFQKKIH
LYEKKLEDYCRILSDIETAVNGIDTDLFGLLQLKTGLAAIVSTVIEEFTL
FMDIAERIAVLHQKTKTLASLSI
3D structure
PDB8tj5 Implications of a multiscale structure of the yeast nuclear pore complex.
ChainF
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F D311 Y314 D42 Y45
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008139 nuclear localization sequence binding
GO:0017056 structural constituent of nuclear pore
GO:0042802 identical protein binding
GO:0140693 molecular condensate scaffold activity
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006405 RNA export from nucleus
GO:0006409 tRNA export from nucleus
GO:0006606 protein import into nucleus
GO:0006913 nucleocytoplasmic transport
GO:0015031 protein transport
GO:0016973 poly(A)+ mRNA export from nucleus
GO:0034398 telomere tethering at nuclear periphery
GO:0051028 mRNA transport
GO:1990000 amyloid fibril formation
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0044613 nuclear pore central transport channel
GO:0044614 nuclear pore cytoplasmic filaments

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tj5, PDBe:8tj5, PDBj:8tj5
PDBsum8tj5
PubMed37738963
UniProtQ02199|NUP49_YEAST Nucleoporin NUP49/NSP49 (Gene Name=NUP49)

[Back to BioLiP]