Structure of PDB 8thu Chain F |
>8thuF (length=84) Species: 8355 (Xenopus laevis) [Search protein sequence] |
HRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIR DAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG |
|
PDB | 8thu Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1. |
Chain | F |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
F |
R45 I46 K79 T80 |
R28 I29 K62 T63 |
|
|
|
|