Structure of PDB 8smh Chain F

Receptor sequence
>8smhF (length=92) Species: 10090 (Mus musculus) [Search protein sequence]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYQKMARALRNYGKTGIIHKTAKKKLTYQFSGEVLGR
3D structure
PDB8smh Dissecting the hydration and dynamics of protein/DNA readout: Modeling with the ETS-family transcription factor PU.1
ChainF
Resolution1.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F S203 K206 R220 R230 R233 K243 K248 L249 S35 K38 R52 R62 R65 K75 K80 L81
BS02 dna F R171 W213 K217 N219 K221 M223 K227 Y235 R3 W45 K49 N51 K53 M55 K59 Y67
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8smh, PDBe:8smh, PDBj:8smh
PDBsum8smh
PubMed38042148
UniProtP17433|SPI1_MOUSE Transcription factor PU.1 (Gene Name=Spi1)

[Back to BioLiP]