Structure of PDB 8s1p Chain F

Receptor sequence

>8s1pF (length=178) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRG
MDIVIVTTANTDEEARELLTQVGMPFQK

3D structure

• PDB: 8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
• Chain: F
• Resolution: 1.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K33 V35 N37 G39 G41 T68 A70 K71 K72 I74 F77 L79 I85 K88 S121 F122 D123 R125 N127 T129 G131 I132 K133 G151 M152 D153	K32 V34 N36 G38 G40 T67 A69 K70 K71 I73 F76 L78 I84 K87 S120 F121 D122 R124 N126 T128 G130 I131 K132 G150 M151 D152
BS02	rna	F	S24 M26 Q27 Q63 K64 V66 V89 T90 R92	S23 M25 Q26 Q62 K63 V65 V88 T89 R91
BS03	rna	F	S73 A75	S72 A74

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
• PDBsum: 8s1p
• PubMed: 38811035
• UniProt: P12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)