Structure of PDB 8rd8 Chain F

Receptor sequence

>8rd8F (length=125) Species: 45610 (Psychrobacter urativorans)

RNYGTGRRKTSTARVFLAKGTGSIVVNGKPLDEYFSRETSRMVVRQPLEL
LDSPTAYDLYITVKGGGISGQAGAIRHGITRALIELDDTNKPALKAAGFV
TRDSRQVERKKLGLRKARKRPQFSK

3D structure

• PDB: 8rd8 A new family of bacterial ribosome hibernation factors
• Chain: F
• Resolution: 2.62 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	Y5 T7 R9 R10 K11 T12 R16 F18 R39 Y62 G67 G68 G69 I70 S71 G72 Q73 R83 K93 K97 T103 R104 S106 R107 Q108 V109 E110 R111 K112 K113 L114 G115 R117 K118 R120 K121 R122 P123 Q124 F125 S126 K127	Y3 T5 R7 R8 K9 T10 R14 F16 R37 Y60 G65 G66 G67 I68 S69 G70 Q71 R81 K91 K95 T101 R102 S104 R105 Q106 V107 E108 R109 K110 K111 L112 G113 R115 K116 R118 K119 R120 P121 Q122 F123 S124 K125

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
• PDBsum: 8rd8
• PubMed: 38355796
• UniProt: A0A0M4T6M9