Structure of PDB 8r5h Chain F |
>8r5hF (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] |
KVSEQLKAASGILKEMFAKCHAAYAWPFYKPVDVEALGLHDYADIIKHPM DMSTIKSKLEAREYRDAQEFGADVRLMFSNAYKYNPPDHEVVAMARKLQD VFEMRFAKMPD |
|
PDB | 8r5h Cullin-RING ligases target substrates with geometrically optimized catalytic partners |
Chain | F |
Resolution | 3.44 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
759 |
F |
W374 P375 L385 L387 |
W26 P27 L37 L39 |
|
|
|