Structure of PDB 8r57 Chain F

Receptor sequence

>8r57F (length=211) Species: 4565 (Triticum aestivum) [Search protein sequence]

TQISKKKKFVSDGVFYAELNEMLTRELAEDGYSGVEVRVTPMRTEIIIRA
TRTQNVLGEKGRRIRELTSVVQKRFNFPENGVELYAEKVVNRGLCAIAQA
ESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAQRAKSMKF
KDGYMISSGQPVNEYIDAAVRHVLLRQGVLGIKVKIMLDWDPKGKLGPTT
PLPDLVTIHPP

3D structure

PDB

8r57 High-Resolution Structure and Internal Mobility of a Plant 40S Ribosomal Subunit.

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	Q4 I5 S6 K7 K8 K9 R27 S139 G140 K141 Q145 R146 A147 K151 Y156 I158 S159 S160 G161 Q162 P163 V172 H174 L176 R178 Q179 G180 V181 K185 P205 D206	Q2 I3 S4 K5 K6 K7 R25 S137 G138 K139 Q143 R144 A145 K149 Y154 I156 S157 S158 G159 Q160 P161 V170 H172 L174 R176 Q177 G178 V179 K183 P203 D204

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8r57, PDBe:8r57, PDBj:8r57
PDBsum	8r57
PubMed	38139282
UniProt	W5I1R7

[Back to BioLiP]