Structure of PDB 8r2i Chain F

Receptor sequence
>8r2iF (length=33) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
YPIFTVRWLAIHGIAVPTIFFLGAITAMQFIQR
3D structure
PDB8r2i Structure of native photosystem II assembly intermediate from Chlamydomonas reinhardtii
ChainF
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM F I14 W19 H23 A26 I3 W8 H12 A15
Gene Ontology
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r2i, PDBe:8r2i, PDBj:8r2i
PDBsum8r2i
PubMed38322422
UniProtQ08363|PSBF_CHLRE Cytochrome b559 subunit beta (Gene Name=psbF)

[Back to BioLiP]