Structure of PDB 8qpa Chain F

Receptor sequence
>8qpaF (length=61) Species: 9606 (Homo sapiens) [Search protein sequence]
SERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAER
RERLRNILSVV
3D structure
PDB8qpa Structural insights into the cross-exon to cross-intron spliceosome switch
ChainF
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F P126 A127 P47 A48
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0030621 U4 snRNA binding
Biological Process
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071005 U2-type precatalytic spliceosome
GO:0097525 spliceosomal snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpa, PDBe:8qpa, PDBj:8qpa
PDBsum8qpa
PubMed38778104
UniProtO43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 (Gene Name=PRPF4)

[Back to BioLiP]