Structure of PDB 8pp7 Chain F |
>8pp7F (length=82) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG |
|
PDB | 8pp7 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1. |
Chain | F |
Resolution | 2.91 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
F |
R35 I46 K79 |
R16 I27 K60 |
|
|
|
|