Structure of PDB 8pkj Chain F

Receptor sequence
>8pkjF (length=77) Species: 10090 (Mus musculus) [Search protein sequence]
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE
HAKRKTVTAMDVVYALKRQGRTLYGFG
3D structure
PDB8pkj Nucleosome-bound NR5A2 structure reveals pioneer factor mechanism by DNA minor groove anchor competition.
ChainF
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R35 R45 I46 R78 K79 T80 R11 R21 I22 R54 K55 T56
BS02 dna F P32 R36 R45 P8 R12 R21
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pkj, PDBe:8pkj, PDBj:8pkj
PDBsum8pkj
PubMed38409506
UniProtP62806|H4_MOUSE Histone H4 (Gene Name=H4c1)

[Back to BioLiP]