Structure of PDB 8ovj Chain F

Receptor sequence
>8ovjF (length=148) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
VSRKSPEYTTLRKSCAPGAIAIILAGRFRGRRAVILKQLPHNGPLVVSGP
MKYNGVPIRRIDSRYVIATSTTVDISSVDTAPITAEVFQRPKAEKPTLVS
DARAQLQKKIDAALIAAIKKDAQGKEKAGYLRSVFTVKPGDAPHRWNW
3D structure
PDB8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
ChainF
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F T28 N60 K110 K113 P114 T10 N42 K92 K95 P96
BS02 rna F A43 G44 R45 R47 P62 M69 K70 G73 P75 R77 Y83 R108 L145 S147 Q154 R179 S180 V181 K185 P186 A25 G26 R27 R29 P44 M51 K52 G55 P57 R59 Y65 R90 L98 S100 Q107 R132 S133 V134 K138 P139
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum8ovj
PubMed38722744
UniProtQ4Q4D3

[Back to BioLiP]