Structure of PDB 8kde Chain F

Receptor sequence
>8kdeF (length=34) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
VYPIFTVRWLAIHGIAVPTIFFLGAITAMQFIQR
3D structure
PDB8kde Structural basis for an early stage of the photosystem II repair cycle in Chlamydomonas reinhardtii.
ChainF
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM F R18 W19 H23 A26 R8 W9 H13 A16
BS02 VTQ F T16 V17 A21 T6 V7 A11
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kde, PDBe:8kde, PDBj:8kde
PDBsum8kde
PubMed38890314
UniProtQ08363|PSBF_CHLRE Cytochrome b559 subunit beta (Gene Name=psbF)

[Back to BioLiP]